Organic Acids
Medchemexpress LLC HOOC-PEG-SH MW 5000 25mg
HOOC-PEG-SH (MW 5000) (HOOC-PEG-Thiol (MW 5000)) is a reactive thiol PEG derivative with a terminal carboxyl group The carboxyl group can react with amine or hydroxyl groups to form a stable amide bond or an unstable ester bond The PEG linkage between the thiol and carboxyl groups has good water solubility flexible linker distance and higher stability[1]
Medchemexpress LLC Glycolic acid oxidase inhibitor 1 | 77529-42-1 | 99.4% | 344.16 | C16H10BrNO3 | 10 MG
Glycolic acid oxidase inhibitor 1 is a small-molecule glycolate oxidase inhibitor described in patent EP0021228A1 and supplied for laboratory research. It is reported to inhibit glycolate oxidase activity and reduce oxalate biosynthesis in perfused liver models; the compound is characterized by CAS 77529-42-1, molecular formula C16H10BrNO3, and molecular weight 344.16 g/mol.
- Research use only.
- Inhibits glycolate oxidase and reduces oxalate biosynthesis in biological models.
- High reported purity (99.35%).
- Available as a solid and as a 10 mM solution in DMSO.
- Characterized by CAS 77529-42-1, formula C16H10BrNO3, and molecular weight 344.16 g/mol.
Medchemexpress LLC Adipic acid dihydrazide-d8 | 1202865-37-9 | 99.0% | 10 MG
Adipic acid dihydrazide-d8 is the deuterium-labeled isotopologue of adipic acid dihydrazide intended for research use. It is used as a stable isotope standard or tracer in analytical and synthetic workflows, particularly mass spectrometry and quantitative method development. The compound is supplied in small quantities for reference and is stored as a powder at low temperature to maintain stability.
- Deuterium-labeled internal standard for mass spectrometry and quantitation.
- Reported purity 99% suitable for analytical applications.
- Supplied in small vial sizes for use as reference standards or tracers.
- Powder is stable at -20°C for long-term storage.
- Applicable to method development, metabolite tracing, and analytical validation.
Ethos Biosciences Glycolic Acid 30PCT 2oz
Glycolic Acid 30% is a concentrated aqueous alpha hydroxy acid (AHA) solution suitable for general laboratory cosmetic formulation and research applications Commonly used as a chemical reagent and formulation component it provides consistent concentration for reliable and reproducible results The solution is appropriate for product development pH adjustment and general chemical processing tasks Supplied in chemically compatible containers Glycolic Acid 30% is intended for professional laboratory and industrial use Not intended for direct consumer use without appropriate formulation and regulatory review
Medchemexpress LLC Pardaxin P5 TFA | 67995-63-5 | ≥98% | 3381.87 | 1 MG
Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.
- Antimicrobial peptide
- Inhibits Escherichia coli with a MIC value of 13 μM
- TFA salt form of Pardaxin P5
- Supplied as a solid
- Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
- Soluble in DMSO (100 mg/mL, requires ultrasonic)
- Targets bacterial organisms and anti-infection pathways
Medchemexpress LLC Thanatin TFA | 99.7% | 2433.92 (free base) | 5 MG
Thanatin TFA is an inducible cationic antimicrobial peptide (AMP) with a single-disulfide-bond-containing β-hairpin structure. It exhibits broad-spectrum activity against Gram-negative and Gram-positive bacteria, as well as various fungal species. This peptide functions by competitively replacing divalent cations from the bacterial outer membrane, leading to its disruption.
- Exhibits broad-spectrum activity against Gram-negative and Gram-positive bacteria.
- Effective against various species of fungi.
- Disrupts bacterial outer membrane.
- Potent inhibitory effect on NDM-1-producing E. coli and K. pneumoniae strains.
- Increases survival rates and decreases bacterial titers in infected mice.
- Rescues pathological damages in a dose-dependent manner in vivo.
Medchemexpress LLC Pardaxin P5 TFA | ≥96% | 3381.87 (free base) | 5 MG
Pardaxin P5 TFA is the TFA salt form of Pardaxin P5, an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM. This peptide is for research use only.
- Inhibits Escherichia coli
- Antimicrobial peptide
- Available in solid form
- Molecular weight of 3381.87 (free base)
- Store at -80°C for 2 years (powder) or 6 months (in solvent)
Medchemexpress LLC 5-FAM-LL-37 TFA | 95.76% | 4851.56 (free acid) | 1 MG
5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37, a LL-37 peptide labeled with fluorescein. It retains the antibacterial and immunomodulatory activities of LL-37 by binding to the bacterial cell membrane, thereby destroying its integrity and demonstrating broad-spectrum antibacterial efficacy.
- Retains antibacterial and immunomodulatory activities
- Binds to bacterial cell membrane
- Demonstrates broad-spectrum antibacterial efficacy
Medchemexpress LLC Cys-TAT(47-57) TFA | 98.1% | 1661.99 | 10 MG
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein. This product is intended for research use only and is not sold to patients.
- Purity: 98.1%
- Molecular weight: 1661.99 (free base)
- Appearance: Solid
- Color: White to off-white
- Solubility in H2O: 100 mg/mL (ultrasonic needed)
- Solubility in DMSO: ≥ 100 mg/mL
